Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Categories
Cart
0

Spokes

2 product(s) found for "Spokes"
Spoke, FRONT wheel - CRF250/300 [06440-KZZ-900]
Spoke, FRONT wheel - CRF250/300 [06440-KZZ-900]
Genuine Honda Front wheel spoke & nipple, to fit : CRF250 L & Rally (2012-20) & CRF300 L & Rally (all years) Part No. 06440-KZZ-900 Alternative Part No. 06440KZZ900. Hereford Honda Parts supplies genuine OE items, that have been imported from Thailand to be sold in the UK at competitive prices. Orders...
£2.00
Details Add To Cart
Spoke, REAR wheel - CRF250/300 [06420-KZZ-900]
Spoke, REAR wheel - CRF250/300 [06420-KZZ-900]
Genuine Honda Rear wheel spoke & nipple, to fit : CRF250 L & Rally (2012-20) CRF300 L & Rally (all years). Part No. 06420-KZZ-900 Alternative Part No. 06420KZZ900. Hereford Honda Parts supplies genuine OE items, that have been imported from Thailand to be sold in the UK at competitive prices. Orders...
£2.00
Details Add To Cart
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract