Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Spark Plug (SIMR8A9) - CRF/CBR 250/300
Spark Plug (SIMR8A9) - CRF/CBR 250/300
Spark Plug (SIMR8A9) - CRF/CBR 250/300

Spark Plug (SIMR8A9) - CRF/CBR 250/300

Product Code: 31916-MEH-003
Brand: Honda
Product Condition: New
weight: 100.0g
£19.00 inc. tax
 Add to Cart
Description

Genuine Honda Spark Plug to fit :

  • CRF250 L, M. & Rally (2013-20)
  • CRF300 L & Rally (2021-25)
  • CB300R / CBR300-NA (2018-24)

Many stockists provide the NGK equivalent being the SIMR8A9, however this plug is actually supplied by Honda as being the correct one for the motorcycle.

Honda main dealer price for comparison: 31916-MEH-003

Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i